PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013843-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 570aa    MW: 65030.8 Da    PI: 7.066
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013843-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR171.32.2e-22103192291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y++YAk++GFsvrk ++++ ++++e+ ++tfvCs+ g + +++ + + +  ++ ++r++C+a l++ + + g w+vt++ ++HnHel
  SMil_00013843-RA_Salv 103 LYCDYAKHTGFSVRKGNQERFSKTKEVRMKTFVCSCRGLTPTTHIEGRLAVYKKHSSRCNCQALLRIARVEGGPWKVTTFIKDHNHEL 190
                            59**************************************999999899999************************************ PP

                   FAR1  90 ap 91 
                            +p
  SMil_00013843-RA_Salv 191 FP 192
                            86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.9E-19103192IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MPNHHLLIIL AIGLRWGCSL DMLKTFLMFV LDEASSIRVS LMRLVASSSE KIGADVKSEF  60
LHETEDVANE VGHSTAVELE AVELEAKLAP GCLVDGFDEA FLLYCDYAKH TGFSVRKGNQ  120
ERFSKTKEVR MKTFVCSCRG LTPTTHIEGR LAVYKKHSSR CNCQALLRIA RVEGGPWKVT  180
TFIKDHNHEL FPKDQAYLLS SSRHISHTKK SMLEALHSAG IPISRACRFM ENEAGGPENT  240
GFIRRDVYHH MDNVRRKSKM ADGDSIAFMQ YFVDNLYTHK FGLQCSWLTV GASLMVGLQL  300
TSASHRLCQW HINQNAPSHF GSLNGNNDFK RAWHHCMNWC ENEEEFESLW KKMIEDYGLA  360
EHRWFGSMYK LRKRWALVFI NSRFSAGLHA TSRSEVTNKV LKDLCASSGS LFDFVQKYEQ  420
IQKDWLVKER ADDALCIGTP GQFVEHNPLV MAAAKYFTRA VFVSYEFEAN HSLNVSIIGN  480
LTADDVQQLR FVVKTTTNPL RTRCVIFHRT SHEASYSNTV YASQETWDLI SRRYPDLMCY  540
NPEGEENWAI LKELYDETDT TTSDSSANDE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-19FAR1-related sequence 5